PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_30668.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 220aa    MW: 24539.4 Da    PI: 4.8783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_30668.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM74.92e-2316960129
                      NAM  60 fFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              fF++r kky++g ++nr+t+sgyWk+tgkd++v+  ++e+vg  +tL+f+ g++p+ge+tdWv+heyrle
  Rsa1.0_30668.1_g00001.1   1 FFCPRLKKYPNGGKANRSTESGYWKTTGKDRDVTY-NDEVVGKIRTLIFHYGKTPRGERTDWVIHEYRLE 69 
                              9**********************************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.424191IPR003441NAC domain
SuperFamilySSF1019412.88E-29191IPR003441NAC domain
PfamPF023652.7E-9168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
FFCPRLKKYP NGGKANRSTE SGYWKTTGKD RDVTYNDEVV GKIRTLIFHY GKTPRGERTD  60
WVIHEYRLED RALVQRNIPQ DTYVICKLFK KKGLGPRHGS EYGAPFKDED WSDEEDIESL  120
VAIPDPGPNK VTSVVASASR SHPPEDCITR VISESCVSDV PQLTAAVLPP LASDVVAHTP  180
LSSSSSPLLE VPHAVQDDDD FYSMLDLFVV DSDESLRLDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-2319275166NO APICAL MERISTEM PROTEIN
1ut4_B5e-2319275166NO APICAL MERISTEM PROTEIN
1ut7_A5e-2319275166NO APICAL MERISTEM PROTEIN
1ut7_B5e-2319275166NO APICAL MERISTEM PROTEIN
4dul_A5e-2319275166NAC domain-containing protein 19
4dul_B5e-2319275166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382770.0KF738277.1 Brassica napus NAC transcription factor 103 (NAC103.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013643048.11e-140PREDICTED: NAC domain-containing protein 82-like
RefseqXP_013643189.11e-140PREDICTED: NAC domain-containing protein 82-like
SwissprotQ9FY823e-71NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A078HYW91e-139A0A078HYW9_BRANA; BnaA06g23210D protein
TrEMBLM4E6591e-139M4E659_BRARP; Uncharacterized protein
STRINGBra024263.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-93NAC domain containing protein 103